Web Analysis for Pittsfieldmahandymanservices - pittsfieldmahandymanservices.com
Call John's Painting & Property Maintenance in Pittsfield, MA at 413-344-0332 now for Handyman Service services you can rely on!
pittsfieldmahandymanservices.com is 7 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pittsfieldmahandymanservices.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 2 | H2 Headings: | 2 |
H3 Headings: | 2 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | UA-42382341-1 |
Websites Hosted on Same IP (i.e. 205.178.153.7)
Dentures Dentist | Newport News, Virginia Affordable Dentures & Implan
Newport News, Virginia Affordable Dentures & Implants offers exceptional dentures services in Newport News, VA. Call us today at 757-932-3022 to schedule an appointment.
Orlando, FL Hvac Contractor | HVAC Contractor 32812 | A-Legend A/C Ser
Call A-Legend A/C Service, Inc. at 407-501-6356 now for exceptional HVAC Contractor service in Orlando, FL!
Canton, MI Lawyer | Lawyer 48187 | Ruark Law Firm
Please call Ruark Law Firm now at 734-335-8991 for quality Lawyer services in Canton, MI.
Insurance Yuma, AZ | Insurance 85367 | Yuma Foothills Insurance
Call Yuma Foothills Insurance now at 928-225-2820 to learn more about Insurance in Yuma, AZ.
Melbourne, FL Insurance Agency | Melbourne, FL Insurance | COBIA Insur
Call COBIA Insurance Agency now at 321-710-7260 to learn more about Insurance in Melbourne, FL.
HTTP Header Analysis
Date: Sun, 19 Feb 2017 17:34:03 GMT
Server: Apache/2.4.6 (Red Hat Enterprise Linux)
Last-Modified: Sat, 18 Feb 2017 03:00:52 GMT
ETag: "1334a-548c53cf50100-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Cache-Control: max-age=691200
Expires: Mon, 27 Feb 2017 17:34:03 GMT
Content-Length: 9600
Connection: close
Content-Type: text/html
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns3a.dns-host.com | 207.204.21.53 | United States of America | |
ns3b.dns-host.com | 207.204.40.53 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
pittsfieldmahandymanservices.com | A | 14395 |
IP: 205.178.153.7 |
pittsfieldmahandymanservices.com | NS | 3599 |
Target: ns3b.dns-host.com |
pittsfieldmahandymanservices.com | NS | 3599 |
Target: ns3a.dns-host.com |
pittsfieldmahandymanservices.com | SOA | 3599 |
MNAME: ns3a.dns-host.com RNAME: hostmaster.pittsfieldmahandymanservices.com Serial: 2017021701 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 3600 |
pittsfieldmahandymanservices.com | MX | 14399 |
Priority: 10 Target: clientmx.natpal.com |
Full WHOIS Lookup
Registry Domain ID: 2098412718_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2017-02-17T15:37:16Z
Creation Date: 2017-02-17T15:37:14Z
Registrar Registration Expiration Date: 2018-02-17T15:37:14Z
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8773812449
Reseller:
Domain Status: clientTransferProhibited http://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: DOMAIN ADMINISTRATOR
Registrant Organization: YODLE
Registrant Street: 330 W34TH ST 18TH FL
Registrant City: NEW YORK
Registrant State/Province: NY
Registrant Postal Code: 10001
Registrant Country: US
Registrant Phone: +1.8772765104
Registrant Phone Ext.:
Registrant Fax:
Registrant Fax Ext.:
Registrant Email: DOMAINREG@YODLE.COM
Registry Admin ID:
Admin Name: DOMAIN ADMINISTRATOR
Admin Organization: YODLE
Admin Street: 330 W34TH ST 18TH FL
Admin City: NEW YORK
Admin State/Province: NY
Admin Postal Code: 10001
Admin Country: US
Admin Phone: +1.8772765104
Admin Phone Ext.:
Admin Fax:
Admin Fax Ext.:
Admin Email: DOMAINREG@YODLE.COM
Registry Tech ID:
Tech Name: DOMAIN ADMINISTRATOR
Tech Organization: YODLE
Tech Street: 330 W34TH ST 18TH FL
Tech City: NEW YORK
Tech State/Province: NY
Tech Postal Code: 10001
Tech Country: US
Tech Phone: +1.8772765104
Tech Phone Ext.:
Tech Fax:
Tech Fax Ext.:
Tech Email: DOMAINREG@YODLE.COM
Name Server: ns3b.dns-host.com
Name Server: ns3a.dns-host.com
DNSSEC: Unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-02-17T15:37:16Z